Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d5cgfb_: 5cgf B: [279549] Other proteins in same PDB: d5cgfa_, d5cgfe_, d5cgfi_, d5cgfj_, d5cgfk_, d5cgfl_, d5cgfn_, d5cgfo_, d5cgfs_, d5cgfw_, d5cgfx_, d5cgfy_, d5cgfz_ automated match to d1rypc_ complexed with cl, mg; mutant |
PDB Entry: 5cgf (more details), 2.8 Å
SCOPe Domain Sequences for d5cgfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cgfb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5cgfb_: