Lineage for d5awwy_ (5aww Y:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256123Fold f.41: Preprotein translocase SecY subunit [103490] (1 superfamily)
    10 transmembrane helices forming of a gated channel
  4. 2256124Superfamily f.41.1: Preprotein translocase SecY subunit [103491] (2 families) (S)
    duplication: consists of two similar structural parts
  5. 2256133Family f.41.1.0: automated matches [191647] (1 protein)
    not a true family
  6. 2256134Protein automated matches [191192] (2 species)
    not a true protein
  7. 2256137Species Thermus thermophilus [TaxId:300852] [279544] (1 PDB entry)
  8. 2256138Domain d5awwy_: 5aww Y: [279545]
    automated match to d3dinc_
    complexed with olc

Details for d5awwy_

PDB Entry: 5aww (more details), 2.72 Å

PDB Description: precise resting state of thermus thermophilus secyeg
PDB Compounds: (Y:) Protein translocase subunit SecY

SCOPe Domain Sequences for d5awwy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5awwy_ f.41.1.0 (Y:) automated matches {Thermus thermophilus [TaxId: 300852]}
mvkafwsalqipelrqrvlftllvlaayrlgafiptpgvdldkiqeflrtaqggvfgiin
lfsggnferfsifalgimpyitaaiimqilvtvvpaleklskegeegrriinqytriggi
algafqgfflataflgaeggrfllpgwspgpffwfvvvvtqvagialllwmaeriteygi
gngtsliifagivvewlpqilrtiglirtgevnlvaflfflafivlafagmaavqqaerr
ipvqyarkvvggrvyggqatyipiklnaagvipiifaaailqipiflaapfqdnpvlqgi
anffnptrpsglfievllvilftyvytavqfdpkriaeslreyggfipgirpgeptvkfl
ehivsrltlwgalflglvtllpqiiqnltgihsiafsgigllivvgvaldtlrqvesqlm
lrsy

SCOPe Domain Coordinates for d5awwy_:

Click to download the PDB-style file with coordinates for d5awwy_.
(The format of our PDB-style files is described here.)

Timeline for d5awwy_: