Lineage for d5adum_ (5adu M:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624340Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2624341Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2624506Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2624507Protein automated matches [191173] (15 species)
    not a true protein
  7. 2624536Species Escherichia coli [TaxId:562] [195685] (6 PDB entries)
  8. 2624538Domain d5adum_: 5adu M: [279542]
    Other proteins in same PDB: d5adus_, d5adut_
    automated match to d3uqyl_
    complexed with cl, f3s, fco, lmt, mg, ni, sf3, sf4, so4

Details for d5adum_

PDB Entry: 5adu (more details), 1.1 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases
PDB Compounds: (M:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5adum_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5adum_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 562]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchnhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfnpclacsth

SCOPe Domain Coordinates for d5adum_:

Click to download the PDB-style file with coordinates for d5adum_.
(The format of our PDB-style files is described here.)

Timeline for d5adum_: