Lineage for d1flja_ (1flj A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) 
Species Rat (Rattus norvegicus), isozyme III [TaxId:10116] [51075] (1 PDB entry) 
Domain d1flja_: 1flj A: [27954]
Details for d1flja_
PDB Entry: 1flj (more details), 1.8 Å
PDB Description: crystal structure of s-glutathiolated carbonic anhydrase iii
SCOP Domain Sequences for d1flja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III}
akewgyashngpehwhelypiakgdnqspielhtkdirhdpslqpwsvsydpgsaktiln
ngktcrvvfddtfdrsmlrggplsgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
hwnpkyntfgealkqpdgiavvgiflkigrekgefqilldaldkiktkgkeapfnhfdps
clfpacrdywtyhgsfttppceecivwlllkepmtvssdqmaklrslfasaeneppvplv
gnwrppqpikgrvvrasfk
SCOP Domain Coordinates for d1flja_:
Click to download the PDB-style file with coordinates for d1flja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1flja_:
- d1flja_ first appeared (with stable ids) in SCOP 1.55
- d1flja_ appears in SCOP 1.59
- d1flja_ appears in SCOP 1.63
- d1flja_ appears in the current release, SCOPe 2.08
View in 3D