Lineage for d5a4fm_ (5a4f M:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248943Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2248944Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2249085Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 2249086Protein automated matches [191173] (9 species)
    not a true protein
  7. 2249101Species Escherichia coli [TaxId:1403831] [279526] (3 PDB entries)
  8. 2249105Domain d5a4fm_: 5a4f M: [279539]
    Other proteins in same PDB: d5a4fs_, d5a4ft_
    automated match to d3uqyl_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5a4fm_

PDB Entry: 5a4f (more details), 1.25 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases.
PDB Compounds: (M:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5a4fm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4fm_ e.18.1.0 (M:) automated matches {Escherichia coli [TaxId: 1403831]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchahlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d5a4fm_:

Click to download the PDB-style file with coordinates for d5a4fm_.
(The format of our PDB-style files is described here.)

Timeline for d5a4fm_: