Lineage for d5a4ml_ (5a4m L:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953511Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 1953512Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 1953653Family e.18.1.0: automated matches [191637] (1 protein)
    not a true family
  6. 1953654Protein automated matches [191173] (5 species)
    not a true protein
  7. 1953660Species Escherichia coli [TaxId:1403831] [279526] (3 PDB entries)
  8. 1953665Domain d5a4ml_: 5a4m L: [279533]
    Other proteins in same PDB: d5a4ms_, d5a4mt_
    automated match to d3uqyl_
    complexed with cl, f3s, mg, nfv, sf3, sf4

Details for d5a4ml_

PDB Entry: 5a4m (more details), 1.7 Å

PDB Description: mechanism of hydrogen activation by nife-hydrogenases
PDB Compounds: (L:) Hydrogenase-1 large chain

SCOPe Domain Sequences for d5a4ml_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4ml_ e.18.1.0 (L:) automated matches {Escherichia coli [TaxId: 1403831]}
stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth

SCOPe Domain Coordinates for d5a4ml_:

Click to download the PDB-style file with coordinates for d5a4ml_.
(The format of our PDB-style files is described here.)

Timeline for d5a4ml_: