Lineage for d4zltl_ (4zlt L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929430Species Mouse (Mus musculus) [TaxId:10090] [279523] (3 PDB entries)
  8. 2929432Domain d4zltl_: 4zlt L: [279525]
    automated match to d1b2ta_
    complexed with nag

Details for d4zltl_

PDB Entry: 4zlt (more details), 3 Å

PDB Description: crystal structure of viral chemokine binding protein r17 in complex with ccl3
PDB Compounds: (L:) C-C motif chemokine 3

SCOPe Domain Sequences for d4zltl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zltl_ d.9.1.0 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tptaccfsysrkiprqfivayfetsslcsqpgvifltkrnrqicadsketwvqeyitdle
ln

SCOPe Domain Coordinates for d4zltl_:

Click to download the PDB-style file with coordinates for d4zltl_.
(The format of our PDB-style files is described here.)

Timeline for d4zltl_: