SCOP 1.73: Domain d9ca2a_: 9ca2 A:

Lineage for d9ca2a_ (9ca2 A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)

8. Domain d9ca2a_: 9ca2 A: [27952]
   complexed with hg, zn; mutant

Details for d9ca2a_

PDB Entry: 9ca2, 2.8 Å

PDB Description: engineering the hydrophobic pocket of carbonic anhydrase ii

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d9ca2a_:

Sequence; same for both SEQRES and ATOM records:

>d9ca2a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglaylgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d9ca2a_:

• d9ca2a_ first appeared (with stable ids) in SCOP 1.55, called d9ca2__
  
• d9ca2a_ was called d9ca2__ in SCOP 1.71
  
• d9ca2a_ appears in SCOP 1.75
  
• d9ca2a_ appears in the current release, SCOPe 2.08