Lineage for d4z3kd_ (4z3k D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1828008Protein Sepiapterin reductase [51767] (2 species)
  7. 1828009Species Human (Homo sapiens) [TaxId:9606] [141874] (6 PDB entries)
    Uniprot P35270 5-261
  8. 1828027Domain d4z3kd_: 4z3k D: [279519]
    automated match to d1z6zb_
    complexed with 4kl, edo, nap, so4

Details for d4z3kd_

PDB Entry: 4z3k (more details), 2.35 Å

PDB Description: human sepiapterin reductase in complex with the cofactor nadp+ and the trypthophan metabolite xanthurenic acid
PDB Compounds: (D:) sepiapterin reductase

SCOPe Domain Sequences for d4z3kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z3kd_ c.2.1.2 (D:) Sepiapterin reductase {Human (Homo sapiens) [TaxId: 9606]}
glgravclltgasrgfgrtlapllasllspgsvlvlsarndealrqleaelgaersglrv
vrvpadlgaeaglqqllgalrelprpkglqrlllinnagslgdvskgfvdlsdstqvnny
walnltsmlcltssvlkafpdspglnrtvvnisslcalqpfkgwalycagkaardmlfqv
laleepnvrvlnyapgpldtdmqqlaretsvdpdmrkglqelkakgklvdckvsaqklls
llekdefksgahvdfyd

SCOPe Domain Coordinates for d4z3kd_:

Click to download the PDB-style file with coordinates for d4z3kd_.
(The format of our PDB-style files is described here.)

Timeline for d4z3kd_: