Lineage for d3x22b_ (3x22 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917190Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1917191Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1917192Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 1917277Protein automated matches [190153] (3 species)
    not a true protein
  7. 1917287Species Escherichia coli [TaxId:83333] [273006] (2 PDB entries)
  8. 1917289Domain d3x22b_: 3x22 B: [279508]
    automated match to d1icub_
    complexed with fmn; mutant

Details for d3x22b_

PDB Entry: 3x22 (more details), 2 Å

PDB Description: crystal structure of escherichia coli nitroreductase nfsb mutant n71s/f123a/f124w
PDB Compounds: (B:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d3x22b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x22b_ d.90.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
aksaagnyvfserkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkawadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d3x22b_:

Click to download the PDB-style file with coordinates for d3x22b_.
(The format of our PDB-style files is described here.)

Timeline for d3x22b_: