Lineage for d4wypa_ (4wyp A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174613Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2174614Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)
  8. 2174732Domain d4wypa_: 4wyp A: [279506]
    automated match to d1kf3a_
    complexed with amp; mutant

Details for d4wypa_

PDB Entry: 4wyp (more details), 1.5 Å

PDB Description: the crystal structure of the a109g mutant of rnase a in complex with 5'amp
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d4wypa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wypa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivgcegnpyvpvhf
dasv

SCOPe Domain Coordinates for d4wypa_:

Click to download the PDB-style file with coordinates for d4wypa_.
(The format of our PDB-style files is described here.)

Timeline for d4wypa_: