Lineage for d4wynb_ (4wyn B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535315Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2535320Species Cow (Bos taurus) [TaxId:9913] [54079] (210 PDB entries)
  8. 2535530Domain d4wynb_: 4wyn B: [279504]
    automated match to d1kf3a_
    mutant

Details for d4wynb_

PDB Entry: 4wyn (more details), 1.81 Å

PDB Description: the crystal structure of the a109g mutant of rnase a
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d4wynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wynb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivgcegnpyvpvhf
dasv

SCOPe Domain Coordinates for d4wynb_:

Click to download the PDB-style file with coordinates for d4wynb_.
(The format of our PDB-style files is described here.)

Timeline for d4wynb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wyna_