SCOPe 2.06: Domain d4wynb_: 4wyn B:

Lineage for d4wynb_ (4wyn B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)

8. Domain d4wynb_: 4wyn B: [279504]
   automated match to d1kf3a_
   mutant

Details for d4wynb_

PDB Entry: 4wyn, 1.81 Å

PDB Description: the crystal structure of the a109g mutant of rnase a

PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d4wynb_:

Sequence; same for both SEQRES and ATOM records:

>d4wynb_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivgcegnpyvpvhf
dasv

Timeline for d4wynb_:

• d4wynb_ first appeared in SCOPe 2.05
  
• d4wynb_ appears in SCOPe 2.07
  
• d4wynb_ appears in the current release, SCOPe 2.08