Lineage for d4wxlb_ (4wxl B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606994Protein automated matches [190200] (10 species)
    not a true protein
  7. 2607020Species Haemophilus influenzae [TaxId:281310] [279491] (2 PDB entries)
  8. 2607026Domain d4wxlb_: 4wxl B: [279499]
    automated match to d1bs4a_
    complexed with bb2, ni

Details for d4wxlb_

PDB Entry: 4wxl (more details), 2.33 Å

PDB Description: crystal structure of a peptide deformylase from haemophilus influenzae complex with actinonin
PDB Compounds: (B:) Peptide deformylase

SCOPe Domain Sequences for d4wxlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxlb_ d.167.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 281310]}
nvliypddhlkvvcepvtevndairkivddmfdtmyqekgiglaapqvdilqriitidve
gdkqnqfvlinpeilasegetgieegclsipgfralvprkekvtvraldrdgkeftldad
gllaiciqheidhlngilfvdylsplkrqrikeklikykkqi

SCOPe Domain Coordinates for d4wxlb_:

Click to download the PDB-style file with coordinates for d4wxlb_.
(The format of our PDB-style files is described here.)

Timeline for d4wxlb_: