Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein automated matches [190200] (9 species) not a true protein |
Species Haemophilus influenzae [TaxId:281310] [279491] (2 PDB entries) |
Domain d4wxlb_: 4wxl B: [279499] automated match to d1bs4a_ complexed with bb2, ni |
PDB Entry: 4wxl (more details), 2.33 Å
SCOPe Domain Sequences for d4wxlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wxlb_ d.167.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 281310]} nvliypddhlkvvcepvtevndairkivddmfdtmyqekgiglaapqvdilqriitidve gdkqnqfvlinpeilasegetgieegclsipgfralvprkekvtvraldrdgkeftldad gllaiciqheidhlngilfvdylsplkrqrikeklikykkqi
Timeline for d4wxlb_: