Lineage for d4rmra_ (4rmr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2745653Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2745791Domain d4rmra_: 4rmr A: [279487]
    automated match to d1k5nb_
    complexed with act, peg; mutant

Details for d4rmra_

PDB Entry: 4rmr (more details), 1.53 Å

PDB Description: crystal structure of the d38n beta-2 microglobulin mutant
PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4rmra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rmra_ b.1.1.2 (A:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievnllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d4rmra_:

Click to download the PDB-style file with coordinates for d4rmra_.
(The format of our PDB-style files is described here.)

Timeline for d4rmra_: