SCOPe 2.05: Domain d4rmta_: 4rmt A:

Lineage for d4rmta_ (4rmt A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (388 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d4rmta_: 4rmt A: [279484]
   automated match to d1k5nb_
   complexed with act, peg, pge; mutant

Details for d4rmta_

PDB Entry: 4rmt, 1.24 Å

PDB Description: crystal structure of the d98n beta-2 microglobulin mutant

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4rmta_:

Sequence; same for both SEQRES and ATOM records:

>d4rmta_ b.1.1.2 (A:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrnm

Timeline for d4rmta_:

• d4rmta_ is new in SCOPe 2.05-stable
  
• d4rmta_ appears in SCOPe 2.06
  
• d4rmta_ appears in the current release, SCOPe 2.08