Lineage for d4rmta_ (4rmt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2348365Protein beta2-microglobulin [88600] (6 species)
  7. 2348380Species Human (Homo sapiens) [TaxId:9606] [88602] (429 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2348402Domain d4rmta_: 4rmt A: [279484]
    automated match to d1k5nb_
    complexed with act, peg, pge; mutant

Details for d4rmta_

PDB Entry: 4rmt (more details), 1.24 Å

PDB Description: crystal structure of the d98n beta-2 microglobulin mutant
PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d4rmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rmta_ b.1.1.2 (A:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrnm

SCOPe Domain Coordinates for d4rmta_:

Click to download the PDB-style file with coordinates for d4rmta_.
(The format of our PDB-style files is described here.)

Timeline for d4rmta_: