Lineage for d4pklb_ (4pkl B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708325Species Trypanosoma brucei [TaxId:999953] [279477] (1 PDB entry)
  8. 2708327Domain d4pklb_: 4pkl B: [279480]
    Other proteins in same PDB: d4pkla2
    automated match to d3rcwh_
    complexed with 1gh, cl, gol, k, po4

Details for d4pklb_

PDB Entry: 4pkl (more details), 1.25 Å

PDB Description: bromodomain of trypanosoma brucei bdf2 with ibet-151
PDB Compounds: (B:) Bromodomain factor 2

SCOPe Domain Sequences for d4pklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pklb_ a.29.2.0 (B:) automated matches {Trypanosoma brucei [TaxId: 999953]}
sfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgiekgtyatd
vdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvvdd

SCOPe Domain Coordinates for d4pklb_:

Click to download the PDB-style file with coordinates for d4pklb_.
(The format of our PDB-style files is described here.)

Timeline for d4pklb_: