SCOPe 2.07: Domain d4pkla1: 4pkl A:9-114

Lineage for d4pkla1 (4pkl A:9-114)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (13 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [279477] (1 PDB entry)

8. Domain d4pkla1: 4pkl A:9-114 [279479]
   Other proteins in same PDB: d4pkla2
   automated match to d3rcwh_
   complexed with 1gh, cl, gol, k, po4

Details for d4pkla1

PDB Entry: 4pkl, 1.25 Å

PDB Description: bromodomain of trypanosoma brucei bdf2 with ibet-151

PDB Compounds: (A:) Bromodomain factor 2

SCOPe Domain Sequences for d4pkla1:

Sequence; same for both SEQRES and ATOM records:

>d4pkla1 a.29.2.0 (A:9-114) automated matches {Trypanosoma brucei [TaxId: 999953]}
sfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgiekgtyatd
vdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv

Timeline for d4pkla1:

• d4pkla1 first appeared in SCOPe 2.05, called d4pkla_
  
• d4pkla1 appears in SCOPe 2.06