Lineage for d4pkla1 (4pkl A:9-114)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708325Species Trypanosoma brucei [TaxId:999953] [279477] (1 PDB entry)
  8. 2708326Domain d4pkla1: 4pkl A:9-114 [279479]
    Other proteins in same PDB: d4pkla2
    automated match to d3rcwh_
    complexed with 1gh, cl, gol, k, po4

Details for d4pkla1

PDB Entry: 4pkl (more details), 1.25 Å

PDB Description: bromodomain of trypanosoma brucei bdf2 with ibet-151
PDB Compounds: (A:) Bromodomain factor 2

SCOPe Domain Sequences for d4pkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkla1 a.29.2.0 (A:9-114) automated matches {Trypanosoma brucei [TaxId: 999953]}
sfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgiekgtyatd
vdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv

SCOPe Domain Coordinates for d4pkla1:

Click to download the PDB-style file with coordinates for d4pkla1.
(The format of our PDB-style files is described here.)

Timeline for d4pkla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pkla2
View in 3D
Domains from other chains:
(mouse over for more information)
d4pklb_