| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
| Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
| Protein automated matches [190615] (15 species) not a true protein |
| Species Trypanosoma brucei [TaxId:999953] [279477] (1 PDB entry) |
| Domain d4pkla1: 4pkl A:9-114 [279479] Other proteins in same PDB: d4pkla2 automated match to d3rcwh_ complexed with 1gh, cl, gol, k, po4 |
PDB Entry: 4pkl (more details), 1.25 Å
SCOPe Domain Sequences for d4pkla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pkla1 a.29.2.0 (A:9-114) automated matches {Trypanosoma brucei [TaxId: 999953]}
sfnkngclvfvsrlwdldklgmfhhpvsaeelpdyhtvikrpvdlssirdgiekgtyatd
vdvqndvarmitnaleynakgstwyqeamsfrktyldlarqsglvv
Timeline for d4pkla1: