SCOPe 2.07: Domain d5egma_: 5egm A:

Lineage for d5egma_ (5egm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Coagulation factor IXa, protease domain [50583] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50585] (20 PDB entries)

8. Domain d5egma_: 5egm A: [279476]
   Other proteins in same PDB: d5egmb_
   automated match to d3lc3a_
   complexed with 5ny, na, nhe

Details for d5egma_

PDB Entry: 5egm, 1.84 Å

PDB Description: development of a novel tricyclic class of potent and selective fixa inhibitors

PDB Compounds: (A:) coagulation factor ix

SCOPe Domain Sequences for d5egma_:

Sequence; same for both SEQRES and ATOM records:

>d5egma_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgasalvlqylrvplvdratclrstkftiynnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d5egma_:

• d5egma_ first appeared in SCOPe 2.05
  
• d5egma_ appears in SCOPe 2.06
  
• d5egma_ appears in the current release, SCOPe 2.08