| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) ![]() |
| Family c.78.2.0: automated matches [227233] (1 protein) not a true family |
| Protein automated matches [226982] (4 species) not a true protein |
| Species Escherichia coli [TaxId:562] [279460] (2 PDB entries) |
| Domain d5elmd2: 5elm D:117-230 [279473] Other proteins in same PDB: d5elma3, d5elmb3, d5elmc3, d5elmd3 automated match to d3ojca2 complexed with glu, gol, no3 |
PDB Entry: 5elm (more details), 2 Å
SCOPe Domain Sequences for d5elmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5elmd2 c.78.2.0 (D:117-230) automated matches {Escherichia coli [TaxId: 562]}
mtrvallgtrytmeqdfyrgrlteqfsinclipeaderakinqiifeelclgqfteasra
yyaqviarlaeqgaqgvifgsteigllvpeersvlpvfdtaaihaedavafmls
Timeline for d5elmd2: