Lineage for d5ella1 (5ell A:1-116)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2514740Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families) (S)
  5. 2514759Family c.78.2.0: automated matches [227233] (1 protein)
    not a true family
  6. 2514760Protein automated matches [226982] (4 species)
    not a true protein
  7. 2514772Species Escherichia coli [TaxId:562] [279460] (2 PDB entries)
  8. 2514773Domain d5ella1: 5ell A:1-116 [279464]
    Other proteins in same PDB: d5ella3, d5ellb3
    automated match to d3ojca1

Details for d5ella1

PDB Entry: 5ell (more details), 1.8 Å

PDB Description: crystal structure of l-aspartate/glutamate-specific racemase from escherichia coli
PDB Compounds: (A:) Asp/Glu_racemase family protein

SCOPe Domain Sequences for d5ella1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ella1 c.78.2.0 (A:1-116) automated matches {Escherichia coli [TaxId: 562]}
mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag

SCOPe Domain Coordinates for d5ella1:

Click to download the PDB-style file with coordinates for d5ella1.
(The format of our PDB-style files is described here.)

Timeline for d5ella1: