SCOPe 2.06: Domain d5ella1: 5ell A:1-116

Lineage for d5ella1 (5ell A:1-116)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.0: automated matches [227233] (1 protein)
   not a true family

6. Protein automated matches [226982] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [279460] (2 PDB entries)

8. Domain d5ella1: 5ell A:1-116 [279464]
   Other proteins in same PDB: d5ella3, d5ellb3
   automated match to d3ojca1

Details for d5ella1

PDB Entry: 5ell, 1.8 Å

PDB Description: crystal structure of l-aspartate/glutamate-specific racemase from escherichia coli

PDB Compounds: (A:) Asp/Glu_racemase family protein

SCOPe Domain Sequences for d5ella1:

Sequence; same for both SEQRES and ATOM records:

>d5ella1 c.78.2.0 (A:1-116) automated matches {Escherichia coli [TaxId: 562]}
mktigllggmswestipyyrlinegikqrlgglhsaqvllhsvdfheieecqrrgewdkt
gdilaeaalglqragaegivlctntmhkvadaiesrctlpflhiadatgraitgag

Timeline for d5ella1:

• d5ella1 first appeared in SCOPe 2.05
  
• d5ella1 appears in SCOPe 2.07
  
• d5ella1 appears in the current release, SCOPe 2.08