SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ec3a1 (5ec3 A:9-174)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2166848Family d.32.1.3: Extradiol dioxygenases [54602] (5 protein domains)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2167074Protein automated matches [276310] (3 species)
    not a true protein
  7. 2167075Species Human (Homo sapiens) [TaxId:9606] [279455] (1 PDB entry)
  8. 2167076Domain d5ec3a1: 5ec3 A:9-174 [279456]
    automated match to d3isqa1
    complexed with co

Details for d5ec3a1

PDB Entry: 5ec3 (more details), 2.1 Å

PDB Description: structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ec3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ec3a1 d.32.1.3 (A:9-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akpergrflhfhsvtfwvgnakqaasfycskmgfeplayrgletgsrevvshvikqgkiv
fvlssalnpwnkemgdhlvkhgdgvkdiafevedcdyivqkarergakimrepwveqdkf
gkvkfavlqtygdtthtlvekmnyigqflpgyeapafmdpllpklp

SCOPe Domain Coordinates for d5ec3a1:

Click to download the PDB-style file with coordinates for d5ec3a1.
(The format of our PDB-style files is described here.)

Timeline for d5ec3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ec3a2