SCOPe 2.06: Domain d5e8fa_: 5e8f A:

Lineage for d5e8fa_ (5e8f A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein GMP-PDE delta [74846] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74847] (23 PDB entries)

8. Domain d5e8fa_: 5e8f A: [279454]
   automated match to d4jv8b_
   complexed with ger

Details for d5e8fa_

PDB Entry: 5e8f, 2.1 Å

PDB Description: structure of fully modified geranylgeranylated pde6c peptide in complex with pde6d

PDB Compounds: (A:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5e8fa_:

Sequence; same for both SEQRES and ATOM records:

>d5e8fa_ b.1.18.8 (A:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvl
tgnviietkffdddllvstsrvrlfyv

Timeline for d5e8fa_:

• d5e8fa_ first appeared in SCOPe 2.05
  
• d5e8fa_ appears in SCOPe 2.07
  
• d5e8fa_ appears in the current release, SCOPe 2.08