| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.8: RhoGDI-like [81288] (3 proteins) |
| Protein GMP-PDE delta [74846] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74847] (25 PDB entries) |
| Domain d5e8fc_: 5e8f C: [279453] automated match to d4jv8b_ complexed with ger |
PDB Entry: 5e8f (more details), 2.1 Å
SCOPe Domain Sequences for d5e8fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e8fc_ b.1.18.8 (C:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv
Timeline for d5e8fc_: