Lineage for d5dqna_ (5dqn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005724Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries)
  8. 2005738Domain d5dqna_: 5dqn A: [279447]
    automated match to d4apya_
    complexed with 1pe, cit, hem, po4; mutant

Details for d5dqna_

PDB Entry: 5dqn (more details), 2.26 Å

PDB Description: polyethylene 600-bound form of p450 cyp125a3 mutant from myobacterium smegmatis - w83y
PDB Compounds: (A:) Cytochrome P450 CYP125

SCOPe Domain Sequences for d5dqna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dqna_ a.104.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ptpnipsdfdfldatlnlerlpveelaelrksepihwvdvpggtggfgdkgywlvtkhad
vkevsrrsdvfgsspdgaipvypqdmtreavdlqravllnmdapqhtrlrkiisrgftpr
aigrledelrsraqkiaqtaaaqgagdfveqvscelplqaiaellgvpqddrdklfrwsn
emtagedpeyadvdpamssfelisyamkmaeeravnptedivtklieadidgeklsddef
gffvvmlavagnettrnsithgmiafaqnpdqwelykkerpetaadeivrwatpvsafqr
taledvelggvqikkgqrvvmsyrsanfdeevfedphtfnilrspnphvgfggtgahyci
ganlarmtinlifnaiadnmpdlkpigaperlksgwlngikhwqvdytga

SCOPe Domain Coordinates for d5dqna_:

Click to download the PDB-style file with coordinates for d5dqna_.
(The format of our PDB-style files is described here.)

Timeline for d5dqna_: