SCOPe 2.07: Domain d5dk4a1: 5dk4 A:2-327

Lineage for d5dk4a1 (5dk4 A:2-327)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
   overall structure is similar to TyrRS

7. Species Bacillus stearothermophilus [TaxId:1422] [52379] (12 PDB entries)

8. Domain d5dk4a1: 5dk4 A:2-327 [279444]
   Other proteins in same PDB: d5dk4a2
   automated match to d1maua_
   complexed with 5bx, atp, gol, mg

Details for d5dk4a1

PDB Entry: 5dk4, 1.9 Å

PDB Description: crystal structure analysis of tryptophanyl-trna synthetase from bacillus stearothermophilus in complex with indolmycin and mg*atp

PDB Compounds: (A:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5dk4a1:

Sequence; same for both SEQRES and ATOM records:

>d5dk4a1 c.26.1.1 (A:2-327) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
ktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirrl
aalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsag
lltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvga
rimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisnl
lniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvld
egaekanrvasemvrkmeqamglgrr

Timeline for d5dk4a1:

• d5dk4a1 first appeared in SCOPe 2.05, called d5dk4a_
  
• d5dk4a1 appears in SCOPe 2.06
  
• d5dk4a1 appears in the current release, SCOPe 2.08