Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species) overall structure is similar to TyrRS |
Species Bacillus stearothermophilus [TaxId:1422] [52379] (13 PDB entries) |
Domain d5dk4a1: 5dk4 A:2-327 [279444] Other proteins in same PDB: d5dk4a2 automated match to d1maua_ complexed with 5bx, atp, gol, mg |
PDB Entry: 5dk4 (more details), 1.9 Å
SCOPe Domain Sequences for d5dk4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dk4a1 c.26.1.1 (A:2-327) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]} ktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirrl aalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsag lltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvga rimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisnl lniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvld egaekanrvasemvrkmeqamglgrr
Timeline for d5dk4a1: