Lineage for d5dk4a1 (5dk4 A:2-327)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860140Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 2860141Species Bacillus stearothermophilus [TaxId:1422] [52379] (13 PDB entries)
  8. 2860146Domain d5dk4a1: 5dk4 A:2-327 [279444]
    Other proteins in same PDB: d5dk4a2
    automated match to d1maua_
    complexed with 5bx, atp, gol, mg

Details for d5dk4a1

PDB Entry: 5dk4 (more details), 1.9 Å

PDB Description: crystal structure analysis of tryptophanyl-trna synthetase from bacillus stearothermophilus in complex with indolmycin and mg*atp
PDB Compounds: (A:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5dk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dk4a1 c.26.1.1 (A:2-327) Tryptophanyl-tRNA synthetase (TrpRS) {Bacillus stearothermophilus [TaxId: 1422]}
ktifsgiqpsgvitignyigalrqfvelqheyncyfcivdqhaitvwqdphelrqnirrl
aalylavgidptqatlfiqsevpahaqaawmlqcivyigelermtqfkeksagkeavsag
lltypplmaadillyntdivpvgedqkqhieltrdlaerfnkrygelftipearipkvga
rimslvdptkkmsksdpnpkayitllddaktiekkiksavtdsegtirydkeakpgisnl
lniystlsgqsieelerqyegkgygvfkadlaqvvietlrpiqeryhhwmeseeldrvld
egaekanrvasemvrkmeqamglgrr

SCOPe Domain Coordinates for d5dk4a1:

Click to download the PDB-style file with coordinates for d5dk4a1.
(The format of our PDB-style files is described here.)

Timeline for d5dk4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dk4a2