SCOPe 2.08: Domain d1fsrb_: 1fsr B:

Lineage for d1fsrb_ (1fsr B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (974 PDB entries)
   Uniprot P00918

8. Domain d1fsrb_: 1fsr B: [27944]
   complexed with cu

Details for d1fsrb_

PDB Entry: 1fsr, 2 Å

PDB Description: x-ray crystal structure of copper-bound f93s/f95l/w97m carbonic anhydrase (caii) variant

PDB Compounds: (B:) carbonic anhydrase II

SCOPe Domain Sequences for d1fsrb_:

Sequence; same for both SEQRES and ATOM records:

>d1fsrb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvh
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d1fsrb_:

• d1fsrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fsrb_ appears in SCOPe 2.07