Lineage for d5bynb_ (5byn B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778976Species Canavalia lineata [TaxId:28957] [193321] (5 PDB entries)
  8. 2778983Domain d5bynb_: 5byn B: [279421]
    automated match to d4i30a_
    complexed with 4wm, ca, cd, edo, mn, peg

Details for d5bynb_

PDB Entry: 5byn (more details), 2.65 Å

PDB Description: canavalia maritima lectin complexed with synthetic selenoamino acid
PDB Compounds: (B:) Concanavalin-A

SCOPe Domain Sequences for d5bynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bynb_ b.29.1.1 (B:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d5bynb_:

Click to download the PDB-style file with coordinates for d5bynb_.
(The format of our PDB-style files is described here.)

Timeline for d5bynb_: