| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein automated matches [190035] (28 species) not a true protein |
| Species Canavalia lineata [TaxId:28957] [193321] (5 PDB entries) |
| Domain d5bynb_: 5byn B: [279421] automated match to d4i30a_ complexed with 4wm, ca, cd, edo, mn, peg |
PDB Entry: 5byn (more details), 2.65 Å
SCOPe Domain Sequences for d5bynb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bynb_ b.29.1.1 (B:) automated matches {Canavalia lineata [TaxId: 28957]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgnsvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d5bynb_: