Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (10 species) not a true protein |
Species Enterovirus d68 [TaxId:42789] [269068] (5 PDB entries) |
Domain d5bnnc_: 5bnn C: [279414] automated match to d3vbhc_ complexed with 4u0 |
PDB Entry: 5bnn (more details), 2.32 Å
SCOPe Domain Sequences for d5bnnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnnc_ b.121.4.0 (C:) automated matches {Enterovirus d68 [TaxId: 42789]} gvptyllpgsgqflttddhssapvlpcfnptpemhipgqirnmlemiqvesmmeinntdg angmerlrvdisvqadldqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc gsfmatgklilcytppggscpttretamlgthivwdfglqssitliipwisgshyrmfns dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqsnhlh gaeaayq
Timeline for d5bnnc_: