Lineage for d5bnoc_ (5bno C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812436Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1813002Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 1813003Protein automated matches [190988] (10 species)
    not a true protein
  7. 1813024Species Enterovirus d68 [TaxId:42789] [269068] (5 PDB entries)
  8. 1813030Domain d5bnoc_: 5bno C: [279413]
    automated match to d3vbhc_
    complexed with 4u1

Details for d5bnoc_

PDB Entry: 5bno (more details), 2.15 Å

PDB Description: crystal structure of human enterovirus d68 in complex with 6'sln
PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d5bnoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnoc_ b.121.4.0 (C:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqirnmlemiqvesmmeinntdg
angmerlrvdisvqadldqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssitliipwisgshyrmfns
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqsnhlh
gaeaayq

SCOPe Domain Coordinates for d5bnoc_:

Click to download the PDB-style file with coordinates for d5bnoc_.
(The format of our PDB-style files is described here.)

Timeline for d5bnoc_: