Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
Protein automated matches [190988] (51 species) not a true protein |
Species Enterovirus d68 [TaxId:42789] [269068] (15 PDB entries) |
Domain d5bnoc_: 5bno C: [279413] automated match to d3vbhc_ |
PDB Entry: 5bno (more details), 2.15 Å
SCOPe Domain Sequences for d5bnoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnoc_ b.121.4.0 (C:) automated matches {Enterovirus d68 [TaxId: 42789]} gvptyllpgsgqflttddhssapvlpcfnptpemhipgqirnmlemiqvesmmeinntdg angmerlrvdisvqadldqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc gsfmatgklilcytppggscpttretamlgthivwdfglqssitliipwisgshyrmfns dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqsnhlh gaeaayq
Timeline for d5bnoc_: