SCOP 1.71: Domain d8ca2__: 8ca2 -

Lineage for d8ca2__ (8ca2 -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (154 PDB entries)

8. Domain d8ca2__: 8ca2 - [27941]
   complexed with hg, zn; mutant

Details for d8ca2__

PDB Entry: 8ca2, 2.4 Å

PDB Description: engineering the hydrophobic pocket of carbonic anhydrase ii

SCOP Domain Sequences for d8ca2__:

Sequence; same for both SEQRES and ATOM records:

>d8ca2__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglahlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d8ca2__:

• d8ca2__ first appeared (with stable ids) in SCOP 1.55
  
• d8ca2__ appears in SCOP 1.69
  
• d8ca2__ is called d8ca2a_ in SCOP 1.73
  
• d8ca2__ appears in the current release, SCOPe 2.08, called d8ca2a_