| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88585] (61 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
| Domain d4znej1: 4zne J:236-339 [279402] Other proteins in same PDB: d4znee2, d4znej2 automated match to d1hzhh3 complexed with nag, zn |
PDB Entry: 4zne (more details), 2.42 Å
SCOPe Domain Sequences for d4znej1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4znej1 b.1.1.2 (J:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d4znej1: