Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
Protein automated matches [190211] (7 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [186967] (7 PDB entries) |
Domain d4zhra1: 4zhr A:1-429 [279397] Other proteins in same PDB: d4zhra2 automated match to d1bqna2 mutant |
PDB Entry: 4zhr (more details), 2.6 Å
SCOPe Domain Sequences for d4zhra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zhra1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkqkksvtvldvgdayfsvpl dkdfrkytaftipsinnetpgiryqynvlpmgwkgspaifqcsmtkilepfrkqnpdivi yqymddlyvgsdleigqhrtkieelrqhllrwgfttpdkkhqkeppflwmgyelhpdkwt vqpivlpekdswtvndiqklvgklnwasqiyagikvrqlckllrgtkaltevvplteeae lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmkga htndvkqlteavqkiatesiviwgktpkfklpiqketweawwteywqatwipewefvntp plvklwyql
Timeline for d4zhra1: