![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein automated matches [190669] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279389] (2 PDB entries) |
![]() | Domain d4zdda_: 4zdd A: [279393] automated match to d1k39b_ complexed with so4 |
PDB Entry: 4zdd (more details), 3 Å
SCOPe Domain Sequences for d4zdda_:
Sequence, based on SEQRES records: (download)
>d4zdda_ c.14.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrff ssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpaigl saalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfky dimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnk ansvevneslkywvdgeplkrfr
>d4zdda_ c.14.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssgrff ssgadfktskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalvalcdivysind kvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimcengfisknfnmp ssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevneslkywvdg eplkrfr
Timeline for d4zdda_: