Lineage for d4zdba_ (4zdb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099728Protein automated matches [190669] (6 species)
    not a true protein
  7. 2099738Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279389] (2 PDB entries)
  8. 2099739Domain d4zdba_: 4zdb A: [279391]
    automated match to d1k39b_
    complexed with caa, gol, so4

Details for d4zdba_

PDB Entry: 4zdb (more details), 2.14 Å

PDB Description: yeast enoyl-coa isomerase (sceci2) complexed with acetoacetyl-coa
PDB Compounds: (A:) 3,2-trans-enoyl-CoA isomerase

SCOPe Domain Sequences for d4zdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zdba_ c.14.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
fnkansvevneslkywvdgeplkrfrq

SCOPe Domain Coordinates for d4zdba_:

Click to download the PDB-style file with coordinates for d4zdba_.
(The format of our PDB-style files is described here.)

Timeline for d4zdba_: