Lineage for d4zdeb_ (4zde B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099728Protein automated matches [190669] (6 species)
    not a true protein
  7. 2099729Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [279382] (3 PDB entries)
  8. 2099733Domain d4zdeb_: 4zde B: [279386]
    automated match to d1k39b_
    complexed with gol, so4; mutant

Details for d4zdeb_

PDB Entry: 4zde (more details), 2.1 Å

PDB Description: crystal structure of yeast d3,d2-enoyl-coa isomerase f268a mutant
PDB Compounds: (B:) 3,2-trans-enoyl-CoA isomerase

SCOPe Domain Sequences for d4zdeb_:

Sequence, based on SEQRES records: (download)

>d4zdeb_ c.14.1.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
fnkansvevneslkywvdgeplkrarq

Sequence, based on observed residues (ATOM records): (download)

>d4zdeb_ c.14.1.3 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgkypsetskwvsnfvarnvyvtdafikhskvlicclngpaiglsaalval
cdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkpfkydimceng
fisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhidafnkansvevn
eslkywvdgeplkrarq

SCOPe Domain Coordinates for d4zdeb_:

Click to download the PDB-style file with coordinates for d4zdeb_.
(The format of our PDB-style files is described here.)

Timeline for d4zdeb_: