Lineage for d4zdca_ (4zdc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835691Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 1835869Protein automated matches [190669] (6 species)
    not a true protein
  7. 1835918Species Saccharomyces cerevisiae [TaxId:4932] [279382] (3 PDB entries)
  8. 1835924Domain d4zdca_: 4zdc A: [279384]
    automated match to d1k39b_
    complexed with co8, gol, so4

Details for d4zdca_

PDB Entry: 4zdc (more details), 2.13 Å

PDB Description: yeast enoyl-coa isomerase complexed with octanoyl-coa
PDB Compounds: (A:) 3,2-trans-enoyl-CoA isomerase

SCOPe Domain Sequences for d4zdca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zdca_ c.14.1.3 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 4932]}
eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg
rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa
iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp
fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida
fnkansvevneslkywvdgeplkrfrq

SCOPe Domain Coordinates for d4zdca_:

Click to download the PDB-style file with coordinates for d4zdca_.
(The format of our PDB-style files is described here.)

Timeline for d4zdca_: