![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
![]() | Protein automated matches [190669] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [279382] (3 PDB entries) |
![]() | Domain d4zdca_: 4zdc A: [279384] automated match to d1k39b_ complexed with co8, gol, so4 |
PDB Entry: 4zdc (more details), 2.13 Å
SCOPe Domain Sequences for d4zdca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zdca_ c.14.1.3 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eirqnekisyriegpffiihlinpdnlnalegedyiylgelleladrnrdvyftiiqssg rffssgadfkgiakaqgddtnkypsetskwvsnfvarnvyvtdafikhskvlicclngpa iglsaalvalcdivysindkvyllypfanlgliteggttvslplkfgtnttyeclmfnkp fkydimcengfisknfnmpssnaeafnakvleelrekvkglylpsclgmkkllksnhida fnkansvevneslkywvdgeplkrfrq
Timeline for d4zdca_: