Lineage for d1fsnb_ (1fsn B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566493Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 566494Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 566495Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 566496Protein Carbonic anhydrase [51071] (10 species)
  7. 566514Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (154 PDB entries)
  8. 566656Domain d1fsnb_: 1fsn B: [27938]
    mutant

Details for d1fsnb_

PDB Entry: 1fsn (more details), 2 Å

PDB Description: x-ray crystal structure of metal-free f93s/f95l/w97m carbonic anhydrase (caii) variant

SCOP Domain Sequences for d1fsnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsnb_ b.74.1.1 (B:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOP Domain Coordinates for d1fsnb_:

Click to download the PDB-style file with coordinates for d1fsnb_.
(The format of our PDB-style files is described here.)

Timeline for d1fsnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fsna_