Lineage for d1fsna_ (1fsn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420906Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2420907Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2420908Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 2420909Protein Carbonic anhydrase [51071] (10 species)
  7. 2420951Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (971 PDB entries)
    Uniprot P00918
  8. 2421803Domain d1fsna_: 1fsn A: [27937]

Details for d1fsna_

PDB Entry: 1fsn (more details), 2 Å

PDB Description: x-ray crystal structure of metal-free f93s/f95l/w97m carbonic anhydrase (caii) variant
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1fsna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsna_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d1fsna_:

Click to download the PDB-style file with coordinates for d1fsna_.
(The format of our PDB-style files is described here.)

Timeline for d1fsna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fsnb_