SCOP 1.75: Domain d1fsna_: 1fsn A:

Lineage for d1fsna_ (1fsn A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (218 PDB entries)
   Uniprot P00918

8. Domain d1fsna_: 1fsn A: [27937]

Details for d1fsna_

PDB Entry: 1fsn, 2 Å

PDB Description: x-ray crystal structure of metal-free f93s/f95l/w97m carbonic anhydrase (caii) variant

PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1fsna_:

Sequence; same for both SEQRES and ATOM records:

>d1fsna_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqshlhmgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

Timeline for d1fsna_:

• d1fsna_ first appeared (with stable ids) in SCOP 1.55
  
• d1fsna_ appears in SCOP 1.73
  
• d1fsna_ appears in SCOPe 2.01
  
• d1fsna_ appears in the current release, SCOPe 2.08