Lineage for d4xdcb3 (4xdc B:210-574)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147779Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2147780Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2147781Family c.96.1.1: Fe-only hydrogenase [53921] (3 protein domains)
  6. 2147792Protein automated matches [279207] (1 species)
    not a true protein
  7. 2147793Species Clostridium pasteurianum [TaxId:1501] [279208] (7 PDB entries)
  8. 2147797Domain d4xdcb3: 4xdc B:210-574 [279368]
    Other proteins in same PDB: d4xdca1, d4xdca2, d4xdca4, d4xdcb1, d4xdcb2, d4xdcb4
    automated match to d3c8ya1
    complexed with 402, fes, mg, sf4

Details for d4xdcb3

PDB Entry: 4xdc (more details), 1.63 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-dithiolato- bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xdcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdcb3 c.96.1.1 (B:210-574) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d4xdcb3:

Click to download the PDB-style file with coordinates for d4xdcb3.
(The format of our PDB-style files is described here.)

Timeline for d4xdcb3: