Lineage for d4xdcb2 (4xdc B:127-209)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2516579Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2516919Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2516920Protein automated matches [229599] (3 species)
    not a true protein
  7. 2516921Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries)
  8. 2516925Domain d4xdcb2: 4xdc B:127-209 [279367]
    Other proteins in same PDB: d4xdca1, d4xdca3, d4xdca4, d4xdcb1, d4xdcb3, d4xdcb4
    automated match to d3c8ya3
    complexed with 402, fes, mg, sf4

Details for d4xdcb2

PDB Entry: 4xdc (more details), 1.63 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-dithiolato- bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xdcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdcb2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d4xdcb2:

Click to download the PDB-style file with coordinates for d4xdcb2.
(The format of our PDB-style files is described here.)

Timeline for d4xdcb2: