Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (24 species) not a true protein |
Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries) |
Domain d4xdca1: 4xdc A:1-126 [279363] Other proteins in same PDB: d4xdca2, d4xdca3, d4xdca4, d4xdcb2, d4xdcb3, d4xdcb4 automated match to d3c8ya2 complexed with 402, fes, mg, sf4 |
PDB Entry: 4xdc (more details), 1.63 Å
SCOPe Domain Sequences for d4xdca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xdca1 d.15.4.0 (A:1-126) automated matches {Clostridium pasteurianum [TaxId: 1501]} mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara skpflp
Timeline for d4xdca1:
View in 3D Domains from other chains: (mouse over for more information) d4xdcb1, d4xdcb2, d4xdcb3, d4xdcb4 |