Lineage for d4xdca1 (4xdc A:1-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2934202Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2934203Protein automated matches [191164] (24 species)
    not a true protein
  7. 2934207Species Clostridium pasteurianum [TaxId:1501] [279203] (17 PDB entries)
  8. 2934212Domain d4xdca1: 4xdc A:1-126 [279363]
    Other proteins in same PDB: d4xdca2, d4xdca3, d4xdca4, d4xdcb2, d4xdcb3, d4xdcb4
    automated match to d3c8ya2
    complexed with 402, fes, mg, sf4

Details for d4xdca1

PDB Entry: 4xdc (more details), 1.63 Å

PDB Description: active semisynthetic [fefe]-hydrogenase cpi with aza-dithiolato- bridged [2fe] cofactor
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xdca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdca1 d.15.4.0 (A:1-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

SCOPe Domain Coordinates for d4xdca1:

Click to download the PDB-style file with coordinates for d4xdca1.
(The format of our PDB-style files is described here.)

Timeline for d4xdca1: