Lineage for d4xddb2 (4xdd B:127-209)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2193004Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2193005Protein automated matches [229599] (3 species)
    not a true protein
  7. 2193006Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries)
  8. 2193008Domain d4xddb2: 4xdd B:127-209 [279358]
    Other proteins in same PDB: d4xdda1, d4xdda3, d4xdda4, d4xddb1, d4xddb3, d4xddb4
    automated match to d3c8ya3
    complexed with cl, fes, gol, mg, sf4

Details for d4xddb2

PDB Entry: 4xdd (more details), 1.6 Å

PDB Description: apo [fefe]-hydrogenase cpi
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xddb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xddb2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d4xddb2:

Click to download the PDB-style file with coordinates for d4xddb2.
(The format of our PDB-style files is described here.)

Timeline for d4xddb2: