Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.0: automated matches [229598] (1 protein) not a true family |
Protein automated matches [229599] (3 species) not a true protein |
Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries) |
Domain d4xddb2: 4xdd B:127-209 [279358] Other proteins in same PDB: d4xdda1, d4xdda3, d4xdda4, d4xddb1, d4xddb3, d4xddb4 automated match to d3c8ya3 complexed with cl, fes, gol, mg, sf4 |
PDB Entry: 4xdd (more details), 1.6 Å
SCOPe Domain Sequences for d4xddb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xddb2 d.58.1.0 (B:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]} kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd dtncllcgqciiacpvaalseks
Timeline for d4xddb2:
View in 3D Domains from other chains: (mouse over for more information) d4xdda1, d4xdda2, d4xdda3, d4xdda4 |